HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QVI5

Names and origin
Entry : E4QVI5 (unreviewed)
Entry name : E4QVI5_HAEI6
Protein names : Putative heavy metal transport protein
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : merT
ORF names : R2866_1349
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : membrane; mercury ion transmembrane transporter activity
GO identifier : GO:0016020; GO:0015097
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 128 residues
>E4QVI5|E4QVI5_HAEI6 Haemophilus influenzae R2866
MTTSLKNSNKSFWVAIATALSAAVASTLCCIAPLIYLVFGVSSTWLISLGEYDYLRIPML
IISLCAFAYGFWLLMFSKKIICSKYISRKKLIVLYWIVFIVMIFFLTYPTILPWILELAN