HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QVI4

Names and origin
Entry : E4QVI4 (unreviewed)
Entry name : E4QVI4_HAEI6
Protein names : Putative heavy metal chaperone protein
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : merP
ORF names : R2866_1348
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : metal ion binding; metal ion transport
GO identifier : GO:0046872; GO:0030001
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 100 residues
>E4QVI4|E4QVI4_HAEI6 Haemophilus influenzae R2866
MKKLCTALLLSLFAISFAHANETKQIVLKVKEMNCQLCAYLVNKELRNIDGVISTKASIK
DGLVTVVEDPNVTNQQLFDAIHKLKYTAEVVN