HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QVI1

Names and origin
Entry : E4QVI1 (unreviewed)
Entry name : E4QVI1_HAEI6
Protein names : Putative uncharacterized protein
Organism : Haemophilus influenzae R2866
Organism ID : 262728
ORF names : R2866_1345
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : peroxidase activity; peroxiredoxin activity
GO identifier : GO:0004601; GO:0051920
Keywords
Ligand & Biological process : Antioxidant; Complete proteome; Disulfide bond; Oxidoreductase; Peroxidase; Redox-active center
Protein sequence
Length : 121 residues
>E4QVI1|E4QVI1_HAEI6 Haemophilus influenzae R2866
MFTDWKEHTSHVKKSFGELGKQYPKMLQAYQALGAAAAEGNVLDAKTRELIALAVAVTTR
CESCISAHAEEAVKAGASEAEVAAALATAIALNAGAAYTYSLRALEAYSVQKA