HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QVG3

Names and origin
Entry : E4QVG3 (unreviewed)
Entry name : E4QVG3_HAEI6
Protein names : UPF0756 membrane protein R2866_1327
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : yeaL
ORF names : R2866_1327
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; plasma membrane
GO identifier : GO:0016021; GO:0005886
Keywords
Ligand & Biological process : Cell membrane; Complete proteome; Membrane; Transmembrane; Transmembrane helix
General annotation
Sequence similarities : Belongs to UPF0756 family
Subcellular location : Cell membrane; Multi-pass membrane protein.
Protein sequence
Length : 162 residues
>E4QVG3|E4QVG3_HAEI6 Haemophilus influenzae R2866
MTLQLNTIALLLVILLILGVLSNNSAITISAAVLLIMQQTFLSSHIPLLEKYGVKIGIII
LTIGVLSPLVSGKIQLPDLSGFLSWKMALSIAVGVLVAWLAGKGVPLMGEQPILVTGLLI
GTIIGVAFLGGIPVGPLIAAGILALLLGKI