HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QVF4

Names and origin
Entry : E4QVF4 (unreviewed)
Entry name : E4QVF4_HAEI6
Protein names : Putative uncharacterized protein yrbA
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : yrbA
ORF names : R2866_1318
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Complete proteome
General annotation
Sequence similarities : Belongs to BolA/yrbA family
Protein sequence
Length : 93 residues
>E4QVF4|E4QVF4_HAEI6 Haemophilus influenzae R2866
MELQKIEQILKDTLNIVEVYAQGENAHFGVIVVSDEIAALSRVKQQQTIYAPLMPYFSTG
EIHALTIKTYTVEKWKRDRALNQFN