HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QVE7

Names and origin
Entry : E4QVE7 (unreviewed)
Entry name : E4QVE7_HAEI6
Protein names : Heme export ABC transporter, ATP-binding component
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : ccmA
ORF names : R2866_1311
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ATP binding; ATP catabolic process; ATPase activity; cytochrome complex assembly; outer membrane-bounded periplasmic space; plasma membrane; transporter activity
GO identifier : GO:0005524; GO:0006200; GO:0016887; GO:0017004; GO:0030288; GO:0005886; GO:0005215
Keywords
Ligand & Biological process : ATP-binding; Cell membrane; Complete proteome; Cytochrome c-type biogenesis; Hydrolase; Membrane; Nucleotide-binding; Transport
General annotation
Sequence similarities : Belongs to ABC transporter superfamily
Protein sequence
Length : 228 residues
>E4QVE7|E4QVE7_HAEI6 Haemophilus influenzae R2866
MFEQHKLSLQNLSCQRGECVLFRALTCDFNSGDFVQIEGHNGIGKTSLLRILAGLAQPLE
GEVRWDSEAISKQREQYHQNLLYLGHLSGVKPELTAWENLQFYQRISQAEQNTDMLWDLL
EKVGLLGREDLPAAQLSAGQQKRIALGRLWLSQTPLWILDEPFTAIDKKGVEILTALFDE
HAQRGGIVLLTSHQEVPSSHLQKLNLAAYKAE