HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QVE4

Names and origin
Entry : E4QVE4 (unreviewed)
Entry name : E4QVE4_HAEI6
Protein names : Heme export ABC transporter, CcmD component
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : ccmD
ORF names : R2866_1308
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : cytochrome complex assembly; heme transport; integral to membrane
GO identifier : GO:0017004; GO:0015886; GO:0016021
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 75 residues
>E4QVE4|E4QVE4_HAEI6 Haemophilus influenzae R2866
MFFQTWSDFFNMGGYGFYVWLSYAVSLVAVIALIVQSVKQRKTVLQNVLREQQREERLQQ
ANKGNTL