HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QVE3

Names and origin
Entry : E4QVE3 (unreviewed)
Entry name : E4QVE3_HAEI6
Protein names : Cytochrome c-type biogenesis protein CcmE (Cytochrome c maturation protein E) (Heme chaperone CcmE)
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : ccmE
ORF names : cycJ
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytochrome complex assembly; integral to membrane; lyase activity; metal ion binding; plasma membrane; protein-heme linkage
GO identifier : GO:0017004; GO:0016021; GO:0016829; GO:0046872; GO:0005886; GO:0017003
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Cytochrome c-type biogenesis; Heme; Iron; Lyase; Membrane; Metal-binding; Signal-anchor; Transmembrane; Transmembrane helix
General annotation
Sequence similarities : Belongs to CcmE/CycJ family
Subcellular location : Cell inner membrane; Single-pass type II membrane protein; Periplasmic side.
Protein sequence
Length : 185 residues
>E4QVE3|E4QVE3_HAEI6 Haemophilus influenzae R2866
MNPRRKSRFKLVIFVVLGISIASGLMLYALRQNIDLFYTPSEVIQGKDNNPNQKPEVGQR
IRVGGMVVEGTVVRDPKSLKVRFDLNDIGPAITVEYEGILPDLFREGQGIVAQGVLTQSA
VLSATEVLAKHDENYVPPELGEKMQKVHKPMGIKAADLKGESARDRQEKEGAK