HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QV90

Names and origin
Entry : E4QV90 (unreviewed)
Entry name : E4QV90_HAEI6
Protein names : Putative 4Fe-4S ferredoxin-type protein
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : fdx-2
ORF names : R2866_0051
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : iron-sulfur cluster binding
GO identifier : GO:0051536
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 94 residues
>E4QV90|E4QV90_HAEI6 Haemophilus influenzae R2866
MALLITSKCTNCDMCLPECPNEAISIGDEIYVIDPILCTECVGHYDTPTCQKVCPITNCI
KPDPEHQETEEQLWERFVMIHHSDKL