HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QV80

Names and origin
Entry : E4QV80 (unreviewed)
Entry name : E4QV80_HAEI6
Protein names : 10 kDa chaperonin (GroES protein) (Protein Cpn10)
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : groES
ORF names : groS
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ATP binding; cytoplasm; protein folding
GO identifier : GO:0005524; GO:0005737; GO:0006457
Keywords
Ligand & Biological process : Chaperone; Complete proteome; Cytoplasm
General annotation
Sequence similarities : Belongs to GroES chaperonin family
Subcellular location : Cytoplasm.
Protein sequence
Length : 104 residues
>E4QV80|E4QV80_HAEI6 Haemophilus influenzae R2866
MNIRPLHDRVIIKREEVETRSAGGIVLTGSAATKSTRAKVLAVGKGRILENGTVQPLDVK
VGDTVIFNDGYGVKSEKIDGEEVLIISENDILAIVE