HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QV78

Names and origin
Entry : E4QV78 (unreviewed)
Entry name : E4QV78_HAEI6
Protein names : 50S ribosomal protein L9
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : rpL9
ORF names : rplI
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : rRNA binding; ribosome; structural constituent of ribosome; translation
GO identifier : GO:0019843; GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein L9P family
Protein sequence
Length : 161 residues
>E4QV78|E4QV78_HAEI6 Haemophilus influenzae R2866
MQVILLDKIVHLGQVGDQVNVKSGFARNFLIPQGKAVMATKANIEHFEARRAELEATAAA
NLAAAQARAAEVTALGSVTIASKAGDEGRLFGAITTRDVAEAVTAAGVKIAKSEVRLPNG
PIRTLGDHDVRFQLHGEVFAALDVIVVAE