HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QV76

Names and origin
Entry : E4QV76 (unreviewed)
Entry name : E4QV76_HAEI6
Protein names : Primosomal replication protein n
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : priB
ORF names : R2866_0037
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA replication, synthesis of RNA primer; primosome complex; single-stranded DNA binding
GO identifier : GO:0006269; GO:1990077; GO:0003697
Keywords
Ligand & Biological process : Complete proteome; DNA replication; DNA-binding; Primosome
General annotation
Domains : SSB domain (1)
Sequence similarities : Belongs to PriB family
Protein sequence
Length : 102 residues
>E4QV76|E4QV76_HAEI6 Haemophilus influenzae R2866
MGVVSQLPKRLKSPSGIEHCKFLLEHRSDQIESGFTRQAWLKMPVQISGNQLIEKTQSIT
VGSKILVVGFITSHKTQSGLCQLVLHAEQIEFID