HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QV74

Names and origin
Entry : E4QV74 (unreviewed)
Entry name : E4QV74_HAEI6
Protein names : Translation initiation factor IF-1
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : infA
ORF names : R2866_0035
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; translation initiation factor activity
GO identifier : GO:0005737; GO:0003743
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Initiation factor; Protein biosynthesis
General annotation
Domains : S1-like domain (1)
Sequence similarities : Belongs to IF-1 family
Subcellular location : Cytoplasm.
Protein sequence
Length : 80 residues
>E4QV74|E4QV74_HAEI6 Haemophilus influenzae R2866
MAKEDCIEMQGTILETLPNTMFRVELENGHVVTAHISGKMRKNYIRILTGDKVTVEMTPY
DLSKGRIIFRSR