HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QV60

Names and origin
Entry : E4QV60 (unreviewed)
Entry name : E4QV60_HAEI6
Protein names : Transcriptional regulator of asparagine biosynthesis
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : asnC
ORF names : R2866_0021
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : intracellular; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription, DNA-dependent
GO identifier : GO:0005622; GO:0043565; GO:0003700; GO:0006351
Keywords
Ligand & Biological process : Complete proteome; DNA-binding; Transcription; Transcription regulation
General annotation
Domains : HTH asnC-type DNA-binding domains (3)
Protein sequence
Length : 162 residues
>E4QV60|E4QV60_HAEI6 Haemophilus influenzae R2866
MHNIDSLDQKILRVLTKDARTPYAEMAKNFGVSPGTIHVRVEKMRQSGIIKGTKVIIDER
KLGYDVCCFIGIILKSAKDYEKVIKKLESFDEVVEAYYTTGNYSIFLKVMTHTIAELHSV
LATKIQLIDEIQSTETLISMQNPILRDIKP