HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QV50

Names and origin
Entry : E4QV50 (unreviewed)
Entry name : E4QV50_HAEI6
Protein names : Protein SlyX homolog
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : slyX
ORF names : R2866_0011
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Complete proteome
General annotation
Sequence similarities : Belongs to SlyX family
Protein sequence
Length : 81 residues
>E4QV50|E4QV50_HAEI6 Haemophilus influenzae R2866
MQIQQMLENRIEELEMKIAFQEQLLDELNHALVQQQFDIDKMQVQLRYMANKLKDFQPSN
IASQSEETPPPHY