HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QV47

Names and origin
Entry : E4QV47 (unreviewed)
Entry name : E4QV47_HAEI6
Protein names : tRNA 2-thiouridine synthesizing protein D (EC 2.8.1.-)
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : tusD
ORF names : R2866_0008
EC number : 2.8.1.-
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; sulfurtransferase activity; tRNA processing
GO identifier : GO:0005737; GO:0016783; GO:0008033
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Transferase
General annotation
Subcellular location : Cytoplasm.
Protein sequence
Length : 138 residues
>E4QV47|E4QV47_HAEI6 Haemophilus influenzae R2866
MRYVIAVKSPIYGKQGAFLAYQFAEALIKKGHEISQIFFFQDGVSNGNALVYPANDEVNL
QKHWQVFSITHNVPLHLCVAASQRRGVVDNLTTPTTGQNNLAKEFIIAGLGEFMAASLNA
DRVITL