HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QV45

Names and origin
Entry : E4QV45 (unreviewed)
Entry name : E4QV45_HAEI6
Protein names : Probable tRNA 2-thiouridine synthesizing protein B
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : tusB
ORF names : R2866_0006
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : cytoplasm; tRNA wobble position uridine thiolation
GO identifier : GO:0005737; GO:0002143
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 103 residues
>E4QV45|E4QV45_HAEI6 Haemophilus influenzae R2866
MLYTFSQSDYPKTELDDYFSYITEKDAVVLWQDGVLLAIKYPDYFAKCKGNCMILKQDIL
ARNLTALLPQSSKIKLISIEELVGITENYLPQLSL