HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QV14

Names and origin
Entry : E4QV14 (unreviewed)
Entry name : E4QV14_HAEI6
Protein names : Anaerobic ribonucleoside-triphosphate reductase-activating protein (EC 1.97.1.-)
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : nrdG
ORF names : R2866_1246
EC number : 1.97.1.-
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : 4 iron, 4 sulfur cluster binding; [formate-C-acetyltransferase]-activating enzyme activity; cytoplasm
GO identifier : GO:0051539; GO:0043365; GO:0005737
Keywords
Ligand & Biological process : Complete proteome; Oxidoreductase
General annotation
Sequence similarities : Belongs to Organic radical-activating enzymes family
Protein sequence
Length : 167 residues
>E4QV14|E4QV14_HAEI6 Haemophilus influenzae R2866
MNYLQYYPTDVINGEGTRCTLFVSGCTHACKGCYNQKSWSFSAGVLFDDVMEQQIINDLK
DTRIKRQGLTLSGGDPLHPRNVETLLPFVQRVKRECPDKDIWVWTGYKLDELDKQQRAML
PYIDVLIDGKFIQEQADPSLVWRGSANQIIHRFKL