HIGDB: Haemophilus influenzae Genome Database

Protein search results for - E4QV05

Names and origin

Entry	:	E4QV05 (unreviewed)
Entry name	:	E4QV05_HAEI6
Protein names	:	Glutaredoxin
Organism	:	Haemophilus influenzae R2866
Organism ID	:	262728
Gene names	:	grxD
ORF names	:	R2866_1236

History

Date of creation	:	2011-02-08
Date of modification	:	2013-11-13
Date of sequence modification	:	2011-02-08

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	cell redox homeostasis; electron carrier activity; protein disulfide oxidoreductase activity
GO identifier	:	GO:0045454; GO:0009055; GO:0015035

Keywords

Ligand & Biological process

Complete proteome

General annotation

Sequence similarities

Belongs to Glutaredoxin family, Monothiol subfamily

Protein sequence

Length

128 residues

>E4QV05|E4QV05_HAEI6 Haemophilus influenzae R2866
MIECLPRLFIGNIMETLDKIKKQISENPILIYMKGSPKFPSCGFSARASEALMNCKVPFG
YVDILQHPDIRAELPTYANWPTFPQLWVEGELIGGCDIILEMYQAGELQTLLAEVAAKYA