HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QUZ7

Names and origin
Entry : E4QUZ7 (unreviewed)
Entry name : E4QUZ7_HAEI6
Protein names : Protein SprT
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : sprT
ORF names : R2866_1228
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; zinc ion binding
GO identifier : GO:0005737; GO:0008270
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Metal-binding; Zinc
General annotation
Domains : SprT-like domain (1)
Sequence similarities : Belongs to SprT family
Subcellular location : Cytoplasm.
Protein sequence
Length : 168 residues
>E4QUZ7|E4QUZ7_HAEI6 Haemophilus influenzae R2866
MQRKLNQSLLLAEAYFKRKFTMPEVNYELRGIKAGVAYLQKNEIKFNRTLLQENTDEFIR
QVVPHELAHLIVYQMFGRVKPHGKEWQLVMNEIFKLPADTCHQFDIKNVQGKTFEYRCAC
QTHFLTIRRHNKIMKENIEYLCKKCKGKLVFVDDEE