HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QUY2

Names and origin
Entry : E4QUY2 (unreviewed)
Entry name : E4QUY2_HAEI6
Protein names : 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.-.-.-)
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : queD
ORF names : R2866_1213
EC number : 4.-.-.-
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : lyase activity; metal ion binding; queuosine biosynthetic process
GO identifier : GO:0016829; GO:0046872; GO:0008616
Keywords
Ligand & Biological process : Complete proteome; Lyase; Metal-binding; Queuosine biosynthesis; Zinc
General annotation
Pathway : Purine metabolism; 7-cyano-7-deazaguanine biosynthesis.
Sequence similarities : Belongs to PTPS family, QueD subfamily
Protein sequence
Length : 153 residues
>E4QUY2|E4QUY2_HAEI6 Haemophilus influenzae R2866
MFKISKEFSFDMAHLLDGHDGKCQNLHGHTYKLQVEISGDLYESGAKKAMVIDFSDLKSI
VKKVILDPMDHAFIYDQTNERESQIATLLQKLNSKTFGVPFRTTAEEIARFIFNRLKHDE
QLSISSIRLWETPTSFCEYQE