HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QUQ1

Names and origin
Entry : E4QUQ1 (unreviewed)
Entry name : E4QUQ1_HAEI6
Protein names : Outer-membrane lipoprotein LolB
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : lolB
ORF names : R2866_1137
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cell outer membrane; plasma membrane; protein transporter activity
GO identifier : GO:0009279; GO:0005886; GO:0008565
Keywords
Ligand & Biological process : Cell membrane; Cell outer membrane; Chaperone; Complete proteome; Lipoprotein; Membrane; Palmitate; Protein transport; Signal; Transport
General annotation
Sequence similarities : Belongs to LolB family
Subcellular location : Cell outer membrane; Lipid-anchor.
Protein sequence
Length : 225 residues
>E4QUQ1|E4QUQ1_HAEI6 Haemophilus influenzae R2866
MNNMKTFKFLTALFATAILTACTLDMERPTNVQYIDKTDVIWQQHLQKIQKIQSYQAKGQ
IGYISPTERFSSRFEWQYQNPKSYTLKLYSLISKSTLLIQMHQSGMTISDNNGNQQSAAN
AKQLLQEIIGMDVPLEHLAYWLKGQPAMNADYQVGTNHLLGAFTYHVDGSQWTADYLTYH
SNNSMPENILLKNDSTKQTLKIRVDEWIY