HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QUL6

Names and origin
Entry : E4QUL6 (unreviewed)
Entry name : E4QUL6_HAEI6
Protein names : Putative uncharacterized protein
Organism : Haemophilus influenzae R2866
Organism ID : 262728
ORF names : R2866_1100
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Predicted
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 62 residues
>E4QUL6|E4QUL6_HAEI6 Haemophilus influenzae R2866
MPTLQCEFWNVGQGLFSSGRIQMGDAPAFHWVYGLQVPHHGSKPILVNKNKRLSIHSI