HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QUJ8

Names and origin
Entry : E4QUJ8 (unreviewed)
Entry name : E4QUJ8_HAEI6
Protein names : Outer membrane-specific lipoprotein ABC transporter, ATP-binding component LolD
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : lolD
ORF names : R2866_1082
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ATP binding; ATP catabolic process; ATPase activity; lipoprotein transporter activity; plasma membrane
GO identifier : GO:0005524; GO:0006200; GO:0016887; GO:0042954; GO:0005886
Keywords
Ligand & Biological process : ATP-binding; Cell inner membrane; Cell membrane; Complete proteome; Hydrolase; Lipoprotein; Membrane; Nucleotide-binding; Transport
General annotation
Sequence similarities : Belongs to ABC transporter superfamily
Subcellular location : Cell inner membrane; Peripheral membrane protein.
Protein sequence
Length : 243 residues
>E4QUJ8|E4QUJ8_HAEI6 Haemophilus influenzae R2866
MNNYLLKCENINKFYQEGENQTQVLKGVSFSMEPAELVAIVGSSGSGKSTLLHTLGGLDQ
PSSGEVFINGQSLQQESANELAALRNRYLGFVYQFHHLMADFTALENVMMPMLIGHQNKT
EAKDRAEKMLSAVGLSHRITHRPSALSGGERQRVAIARALVNNPSLVLADEPTGNLDHKT
TESIFELIQQLNQEQNIAFLLVTHDMGLAEKLSRRLVMQDGLLKEGA