HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QUI4

Names and origin
Entry : E4QUI4 (unreviewed)
Entry name : E4QUI4_HAEI6
Protein names : Glutaredoxin 1
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : grxA
ORF names : R2866_1067
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : cell redox homeostasis; electron carrier activity; protein disulfide oxidoreductase activity
GO identifier : GO:0045454; GO:0009055; GO:0015035
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 95 residues
>E4QUI4|E4QUI4_HAEI6 Haemophilus influenzae R2866
MFVTIFGRPGCPYCVRAKNLAERLKGEVADFDYRYVDIHAEGITKEDLSKSVGKPVETVP
QIFIDEKPIGGCTDFEALMKEQFGIVA