HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QUH0

Names and origin
Entry : E4QUH0 (unreviewed)
Entry name : E4QUH0_HAEI6
Protein names : DPS ferritin-like protein (EC 1.16.-.-)
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : dpsA
ORF names : R2866_1053
EC number : 1.16.-.-
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cellular iron ion homeostasis; ferric iron binding; oxidoreductase activity, oxidizing metal ions; response to stress
GO identifier : GO:0006879; GO:0008199; GO:0016722; GO:0006950
Keywords
Ligand & Biological process : Complete proteome; Oxidoreductase
General annotation
Sequence similarities : Belongs to Dps family
Protein sequence
Length : 172 residues
>E4QUH0|E4QUH0_HAEI6 Haemophilus influenzae R2866
MSKTSIGLDKVQSAELADKLNELLATYQVFYTNVRGYHWNIKGVNFFALHAKFEEIYTNL
VARVDEVAERILTLGYTPNNAYSQYLKISRIKEDIAVSEAQECLSGTLQGLKTLLDQQRE
ILAFANNANDEGTASQMSDYIKEQEKLVWMFQAACQTCHN