HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QUE8

Names and origin
Entry : E4QUE8 (unreviewed)
Entry name : E4QUE8_HAEI6
Protein names : Sulfurtransferase (EC 2.8.1.-)
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : tusE
ORF names : R2866_1031
EC number : 2.8.1.-
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : transferase activity
GO identifier : GO:0016740
Keywords
Ligand & Biological process : Complete proteome; Transferase
General annotation
Sequence similarities : Belongs to DsrC/tusE family
Protein sequence
Length : 117 residues
>E4QUE8|E4QUE8_HAEI6 Haemophilus influenzae R2866
MLNINGIEVETDKDGYLLHSQQWNEDVAQAIAQLESIELTDAHWEVIYFVRDFYQEYNTS
PAIRMLVKAMAEKLGADKGNSRYLQRLFPEGPAKQATKLAGLPKPAKCL