HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QU87

Names and origin
Entry : E4QU87 (unreviewed)
Entry name : E4QU87_HAEI6
Protein names : Putative uncharacterized protein
Organism : Haemophilus influenzae R2866
Organism ID : 262728
ORF names : R2866_0968
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : DNA binding; DNA integration; DNA recombination
GO identifier : GO:0003677; GO:0015074; GO:0006310
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 56 residues
>E4QU87|E4QU87_HAEI6 Haemophilus influenzae R2866
MHFHDTRREALTRLSKKVDVMTLAKISGHRDISILQNVYYAPDMAEVAELLD