HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QU81

Names and origin
Entry : E4QU81 (unreviewed)
Entry name : E4QU81_HAEI6
Protein names : NADP-dependent L-serine/L-allo-threonine dehydrogenase (EC 1.1.1.-)
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : ydfG
ORF names : R2866_0961
EC number : 1.1.1.-
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : oxidoreductase activity
GO identifier : GO:0016491
Keywords
Ligand & Biological process : Complete proteome; Oxidoreductase
Protein sequence
Length : 96 residues
>E4QU81|E4QU81_HAEI6 Haemophilus influenzae R2866
MKTTTALVTGATAGFGLAICKKLIETGYKVIGTGRRADRLAEIHSQLGNNFLPLAFDIRD
EQATINALNTLPESWQAVDLLVNNNLNT