HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QU77

Names and origin
Entry : E4QU77 (unreviewed)
Entry name : E4QU77_HAEI6
Protein names : Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase (EC 4.2.-.-)
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : ybaK
ORF names : R2866_0957
EC number : 4.2.-.-
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : aminoacyl-tRNA editing activity; cytoplasm; ligase activity; lyase activity; regulation of translational fidelity; translation
GO identifier : GO:0002161; GO:0005737; GO:0016874; GO:0016829; GO:0006450; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Ligase; Lyase; Protein biosynthesis
General annotation
Sequence similarities : Belongs to Prolyl-tRNA editing family, YbaK/EbsC subfamily
Subcellular location : Cytoplasm.
Protein sequence
Length : 170 residues
>E4QU77|E4QU77_HAEI6 Haemophilus influenzae R2866
MTPAIDLLKKQKIPFILHTYDHDPNNQHFGDEAAEKLGIDPNRSFKTLLVAENGNQKKLA
CFVLATANMLNLKKAAKSIGVKKVEMADKDAAQKSTGYLVGGISPLGQKKRVKTVINSTA
LEFETIYVSGGKRGLSVEIAPQDLAKVLGAEFTDIVDE