HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QU76

Names and origin
Entry : E4QU76 (unreviewed)
Entry name : E4QU76_HAEI6
Protein names : Cold shock protein CspD
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : cspD
ORF names : R2866_0956
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; cytoplasm; regulation of transcription, DNA-dependent; response to stress
GO identifier : GO:0003677; GO:0005737; GO:0006355; GO:0006950
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm
General annotation
Domains : CSD (cold-shock) domain (1)
Subcellular location : Cytoplasm.
Protein sequence
Length : 80 residues
>E4QU76|E4QU76_HAEI6 Haemophilus influenzae R2866
MEIGIVKWFNNAKGFGFISAEGVDADIFAHYSVIEMDGYRSLKAGQKVQFEVLHSDKGSH
ATKIIPIADTQE