HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QU75

Names and origin
Entry : E4QU75 (unreviewed)
Entry name : E4QU75_HAEI6
Protein names : UPF0181 protein R2866_0955
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : yoaH
ORF names : R2866_0955
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Complete proteome
General annotation
Sequence similarities : Belongs to UPF0181 family
Protein sequence
Length : 56 residues
>E4QU75|E4QU75_HAEI6 Haemophilus influenzae R2866
MFDINLTHEQQQKAVEQIQELMAKGISSGEAIQIVAKALREIHKNDKKTPEN