HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QU58

Names and origin
Entry : E4QU58 (unreviewed)
Entry name : E4QU58_HAEI6
Protein names : UPF0263 protein R2866_0938
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : yciU
ORF names : R2866_0938
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Complete proteome
General annotation
Sequence similarities : Belongs to UPF0263 family
Protein sequence
Length : 115 residues
>E4QU58|E4QU58_HAEI6 Haemophilus influenzae R2866
MTTEIKKLDPDTAIDIAYDIFLEMAGENLDPADILLFNLQFEERGGVEFVETADNWEEEI
GVLIDPEEYAEVWVGLVNEQDEMDDVFAKFLISHREEDREFHVIWKK