HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QU42

Names and origin
Entry : E4QU42 (unreviewed)
Entry name : E4QU42_HAEI6
Protein names : RNA-binding protein YhbY
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : yhbY
ORF names : R2866_0922
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : RNA binding
GO identifier : GO:0003723
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 107 residues
>E4QU42|E4QU42_HAEI6 Haemophilus influenzae R2866
MTTLSTKQKQFLKGLAHHLNPVVMLGGNGLTEGVLAEIENALNHHELIKVKVAGADRETK
QLIINAIVRETKAAQVQTIGHILVLYRPSEEAKIQLPRK