HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QU36

Names and origin
Entry : E4QU36 (unreviewed)
Entry name : E4QU36_HAEI6
Protein names : 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase (EC 4.2.1.59) (3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabA) (Beta-hydroxydecanoyl thioester dehydrase) (Trans-2-decenoyl-[acyl-carrier-protein] isomerase)
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : fabA
ORF names : R2866_0916
EC number : 4.2.1.59
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase activity; 3-hydroxyoctanoyl-[acyl-carrier-protein] dehydratase activity; cytoplasm; fatty acid biosynthetic process; trans-2-decenoyl-acyl-carrier-protein isomerase activity
GO identifier : GO:0008693; GO:0047451; GO:0005737; GO:0006633; GO:0034017
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Fatty acid biosynthesis; Fatty acid metabolism; Isomerase; Lipid biosynthesis; Lipid metabolism; Lyase
General annotation
Pathway : Lipid metabolism; fatty acid biosynthesis.
Sequence similarities : Belongs to Thioester dehydratase family, FabA subfamily
Subcellular location : Cytoplasm.
Protein sequence
Length : 189 residues
>E4QU36|E4QU36_HAEI6 Haemophilus influenzae R2866
MQNACTLNKKSSYSYDDLLASGRGELFGKEGPQLPAPTMLMMDRIIEMNEETGAFGKGYI
EAELDIKPELPFFGCHFIGDPVMPGCLGLDAMWQLVGFYLGWIGGKGKGRALGVGEVKFT
GQILPTAKKVVYRIHMKRVINRKLVMGMADGEVEVDGRVIYTATDLKVGLFQDTSTF