HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QU29

Names and origin
Entry : E4QU29 (unreviewed)
Entry name : E4QU29_HAEI6
Protein names : Translation initiation factor IF-3
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : infC
ORF names : R2866_0909
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; translation initiation factor activity
GO identifier : GO:0005737; GO:0003743
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Initiation factor; Protein biosynthesis
General annotation
Sequence similarities : Belongs to IF-3 family
Subcellular location : Cytoplasm.
Protein sequence
Length : 192 residues
>E4QU29|E4QU29_HAEI6 Haemophilus influenzae R2866
MKTVKKAPAVNRPNRINEEIRVKEVRLIDQNGEQAGIVSIQQALEMAEQAELDLVEISPN
AEPPVCRIMNYGKFLYEKSKTAKEQKKKQKVVQVKEIKFRPGTDEGDYQVKLRSLIRFLE
DGDKAKITVRFRGREMAHQDIGLDVLERVKNDLAEISVVESAPGKLEGRQAVMVLAPKKK