HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QU15

Names and origin
Entry : E4QU15 (unreviewed)
Entry name : E4QU15_HAEI6
Protein names : Integration host factor subunit alpha (IHF-alpha)
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : ihfA
ORF names : himA
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; DNA recombination; regulation of transcription, DNA-dependent; regulation of translation; transcription, DNA-dependent
GO identifier : GO:0003677; GO:0006310; GO:0006355; GO:0006417; GO:0006351
Keywords
Ligand & Biological process : Complete proteome; DNA recombination; DNA-binding; Transcription; Transcription regulation; Translation regulation
General annotation
Sequence similarities : Belongs to Bacterial histone-like protein family
Protein sequence
Length : 104 residues
>E4QU15|E4QU15_HAEI6 Haemophilus influenzae R2866
MATITKLDIIEYLSDKYHLSKQDTKNVVENFLEEIRSSLESGQDVKLSGFGNFELRDKSS
RPGRNPKTGDVVPVSARRVVTFKPGQKLRARVEKTK