HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E4QTZ9

Names and origin
Entry : E4QTZ9 (unreviewed)
Entry name : E4QTZ9_HAEI6
Protein names : UPF0299 membrane protein R2866_0879
Organism : Haemophilus influenzae R2866
Organism ID : 262728
Gene names : lrgA
ORF names : R2866_0879
History
Date of creation : 2011-02-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-02-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : hydrolase activity; integral to membrane; plasma membrane
GO identifier : GO:0016787; GO:0016021; GO:0005886
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Hydrolase; Membrane; Transmembrane; Transmembrane helix
General annotation
Sequence similarities : Belongs to UPF0299 family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Protein sequence
Length : 152 residues
>E4QTZ9|E4QTZ9_HAEI6 Haemophilus influenzae R2866
MIQKLFLLVRSLVILSIMLYLGNLIAYYIPSGVPGSIWGLLLLFLGLTTRVIHLNWIYLG
ASLLIRFMAVLFVPVSVGIIKYSDLLIEQINILLVPNIVSTCVTLLVIGFLGHYLYQMQS
FTHKRKKVIKRRENQVKQAN