HIGDB: Haemophilus influenzae Genome Database

Protein search results for - E3GVX8

Names and origin

Entry	:	E3GVX8 (unreviewed)
Entry name	:	E3GVX8_HAEI2
Protein names	:	DNA-binding protein fis
Organism	:	Haemophilus influenzae R2846
Organism ID	:	262727
Gene names	:	fis
ORF names	:	R2846_1331

History

Date of creation	:	2011-01-11
Date of modification	:	2013-10-16
Date of sequence modification	:	2011-01-11

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription, DNA-dependent
GO identifier	:	GO:0043565; GO:0003700; GO:0006351

Keywords

Ligand & Biological process

Activator; Complete proteome; DNA-binding; Transcription; Transcription regulation

General annotation

Sequence similarities

Belongs to Transcriptional regulatory fis family

Protein sequence

Length

107 residues

>E3GVX8|E3GVX8_HAEI2 Haemophilus influenzae R2846
MLEQQRNSADALTVSVLNAQSQVTSKPLRDSVKQALRNYLAQLDGQDVNDLYELVLAEVE
HPMLDMIMQYTRGNQTRAANMLGINRGTLRKKLKKYGMG