HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GVW1

Names and origin
Entry : E3GVW1 (unreviewed)
Entry name : E3GVW1_HAEI2
Protein names : 50S ribosomal protein L34
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : rpL34
ORF names : rpmH
History
Date of creation : 2011-01-11
Date of modification : 2013-05-29
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ribosome; structural constituent of ribosome; translation
GO identifier : GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; Ribonucleoprotein; Ribosomal protein
General annotation
Sequence similarities : Belongs to Ribosomal protein L34P family
Protein sequence
Length : 48 residues
>E3GVW1|E3GVW1_HAEI2 Haemophilus influenzae R2846
MKRTFQPSVLKRSRTHGFRARMATKNGRQVLARRRAKGRKSLSA