HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GVV9

Names and origin
Entry : E3GVV9 (unreviewed)
Entry name : E3GVV9_HAEI2
Protein names : Putative membrane protein insertion efficiency factor
Organism : Haemophilus influenzae R2846
Organism ID : 262727
ORF names : R2846_1312
History
Date of creation : 2011-01-11
Date of modification : 2013-05-29
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : plasma membrane
GO identifier : GO:0005886
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Membrane
General annotation
Sequence similarities : Belongs to UPF0161 family
Subcellular location : Cell inner membrane; Peripheral membrane protein; Cytoplasmic side.
Protein sequence
Length : 94 residues
>E3GVV9|E3GVV9_HAEI2 Haemophilus influenzae R2846
MAETHSLGTKILIKIIRLYQIMISPFIGARCRFVPTCSCYGIEALKTHGLLKGGWLTLKR
VLKCHPLNAGGFDPVPPKTNNNDEKK