HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GVT2

Names and origin
Entry : E3GVT2 (unreviewed)
Entry name : E3GVT2_HAEI2
Protein names : Putative heavy metal transport protein
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : merT
ORF names : R2846_1284
History
Date of creation : 2011-01-11
Date of modification : 2013-05-29
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : membrane; mercury ion transmembrane transporter activity
GO identifier : GO:0016020; GO:0015097
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 128 residues
>E3GVT2|E3GVT2_HAEI2 Haemophilus influenzae R2846
MTTYLKNSNKSFWVAIAAALSAAVASTLCCIAPLIYLVFGVSSTWLIGLGEYDYLRIPML
IISLCAFAYGFWLLMFSKKIICSKYISRKKLIVLYWIVFIVMIFFLTYPTILPWILELAN