HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GVS8

Names and origin
Entry : E3GVS8 (unreviewed)
Entry name : E3GVS8_HAEI2
Protein names : Putative uncharacterized protein
Organism : Haemophilus influenzae R2846
Organism ID : 262727
ORF names : R2846_1280
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : peroxidase activity; peroxiredoxin activity
GO identifier : GO:0004601; GO:0051920
Keywords
Ligand & Biological process : Antioxidant; Complete proteome; Disulfide bond; Oxidoreductase; Peroxidase; Redox-active center
Protein sequence
Length : 121 residues
>E3GVS8|E3GVS8_HAEI2 Haemophilus influenzae R2846
MFTDWKEHTSHVKKSFGELGKQYPKMLQAYQALGAAAAEGNVLDAKTRELIALAVAVTTR
CESCISAHAEEAVKAGASEAEVAAALATAIALNAGAAYTYSLRALEAYSVQKA