HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GVQ5

Names and origin
Entry : E3GVQ5 (unreviewed)
Entry name : E3GVQ5_HAEI2
Protein names : Putative uncharacterized protein yrbA
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : yrbA
ORF names : R2846_1256
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Complete proteome
General annotation
Sequence similarities : Belongs to BolA/yrbA family
Protein sequence
Length : 93 residues
>E3GVQ5|E3GVQ5_HAEI2 Haemophilus influenzae R2846
MELQKIEQILKDTLNIVEVYAQGENAHFGVIVVSDEIAALSRVKQQQTIYAPLMPYFSTG
EIHALTIKTYTVEKWKRDRALNQFN