HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GVP6

Names and origin
Entry : E3GVP6 (unreviewed)
Entry name : E3GVP6_HAEI2
Protein names : Primosomal replication protein n
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : priB
ORF names : R2846_0039
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA replication, synthesis of RNA primer; primosome complex; single-stranded DNA binding
GO identifier : GO:0006269; GO:1990077; GO:0003697
Keywords
Ligand & Biological process : Complete proteome; DNA replication; DNA-binding; Primosome
General annotation
Domains : SSB domain (1)
Sequence similarities : Belongs to PriB family
Protein sequence
Length : 102 residues
>E3GVP6|E3GVP6_HAEI2 Haemophilus influenzae R2846
MGVVSQLPKRLKSPSGIEHCKFLLEHRSDQIESGFTRQAWLKMPVQISGNQLIEKTQSIT
VGSKILVVGFITSHKTQSGLCQLVLHAEQIEFID