HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GVN0

Names and origin
Entry : E3GVN0 (unreviewed)
Entry name : E3GVN0_HAEI2
Protein names : Heat shock protein 15
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : hslR
ORF names : R2846_0022
History
Date of creation : 2011-01-11
Date of modification : 2013-05-29
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; cellular response to heat; ribosomal large subunit binding; single-stranded RNA binding
GO identifier : GO:0003677; GO:0034605; GO:0043023; GO:0003727
Keywords
Ligand & Biological process : Complete proteome; DNA-binding; RNA-binding; Stress response
General annotation
Sequence similarities : Belongs to HSP15 family
Protein sequence
Length : 143 residues
>E3GVN0|E3GVN0_HAEI2 Haemophilus influenzae R2846
MAEKEVRLDKWLWAARFYKTRSIAKAMIESGKVHYNNQRAKVSKIVEVGAMLKLRQGNEE
KEIKIIALSDQRRGAPEAQLLYQETESSVKKREEIAWARKNNSLSMPHPDRRPNKKERRD
LLKFKHQDKFE