HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GVM3

Names and origin
Entry : E3GVM3 (unreviewed)
Entry name : E3GVM3_HAEI2
Protein names : Transcription elongation factor GreB (Transcript cleavage factor GreA) (Transcript cleavage factor GreB) (Transcription elongation factor GreA)
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : greB
ORF names : greA
History
Date of creation : 2011-01-11
Date of modification : 2013-12-11
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; regulation of DNA-dependent transcription, elongation; transcription, DNA-dependent; translation elongation factor activity
GO identifier : GO:0003677; GO:0032784; GO:0006351; GO:0003746
Keywords
Ligand & Biological process : Coiled coil; Complete proteome; DNA-binding; Elongation factor; Protein biosynthesis; Transcription; Transcription regulation
General annotation
Sequence similarities : Belongs to GreA/GreB family
Protein sequence
Length : 174 residues
>E3GVM3|E3GVM3_HAEI2 Haemophilus influenzae R2846
MAKSNYITRQGWNELDQELKFLWKEERPKVTQAVSDAAALGDRSENAEYIYGKRRLREID
RRVRFLTKRLEVLQIVDYNPKQEGKVFFGAWVELENEEGEIKQYRIVGCDEFAPAKNWIS
IDSPVARALIGKTLDDEVRVETPSGFITLYINKIWYENNSEK