HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GVL9

Names and origin
Entry : E3GVL9 (unreviewed)
Entry name : E3GVL9_HAEI2
Protein names : Protein SlyX homolog
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : slyX
ORF names : R2846_0011
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Complete proteome
General annotation
Sequence similarities : Belongs to SlyX family
Protein sequence
Length : 81 residues
>E3GVL9|E3GVL9_HAEI2 Haemophilus influenzae R2846
MQIQQMLENRIEELEMKIAFQEQLLDELNHALVQQQFDIDKMQVQLRYMANKLKDFQPSN
IASQSEETPPPHY