HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GVL6

Names and origin
Entry : E3GVL6 (unreviewed)
Entry name : E3GVL6_HAEI2
Protein names : tRNA 2-thiouridine synthesizing protein D (EC 2.8.1.-)
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : tusD
ORF names : R2846_0008
EC number : 2.8.1.-
History
Date of creation : 2011-01-11
Date of modification : 2013-10-16
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; sulfurtransferase activity; tRNA processing
GO identifier : GO:0005737; GO:0016783; GO:0008033
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Transferase
General annotation
Subcellular location : Cytoplasm.
Protein sequence
Length : 138 residues
>E3GVL6|E3GVL6_HAEI2 Haemophilus influenzae R2846
MRYIIAVKSPIYGKQGAFLAYQFANALIKKGHEISQIFFFQDGVSNGNALVYPANDEVNL
QKHWQMFSITHNVPLHLCVAASQRRGVVDNLTTPTTAHYNLAEGFIIAGLGEFIAASLNA
DRVITL