HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E3GVL4

Names and origin
Entry : E3GVL4 (unreviewed)
Entry name : E3GVL4_HAEI2
Protein names : Probable tRNA 2-thiouridine synthesizing protein B
Organism : Haemophilus influenzae R2846
Organism ID : 262727
Gene names : tusB
ORF names : R2846_0006
History
Date of creation : 2011-01-11
Date of modification : 2013-05-29
Date of sequence modification : 2011-01-11
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : cytoplasm; tRNA wobble position uridine thiolation
GO identifier : GO:0005737; GO:0002143
Keywords
Ligand & Biological process : Complete proteome
Protein sequence
Length : 103 residues
>E3GVL4|E3GVL4_HAEI2 Haemophilus influenzae R2846
MLYTFSQSDYPKTELDDYFSYITEKDAVVLWQDGVLLAIKYPDYFAKCKGNCMILKQDIL
ARNLTALLPQSSKIKLISIEELVGITENYLPQLSL